This is a working overview of orthogonal methods, written for readers who want more than a one-paragraph summary but less than a textbook.
This page was last updated on 2026-04-23 and is reviewed periodically as new material appears.
Reported purity values can differ between laboratories even for the same sample. Variations arise from column chemistry, mobile-phase composition, gradient slope, detection wavelength, injection load, and integration rules. Area percent also assumes that all species have similar response factors, which is not always true. Method validation examines specificity, linearity, accuracy, precision, limit of detection, and limit of quantitation. When comparing certificates, the method description and representative chromatogram are as important as the headline percentage.
Purity and potency are related but distinct concepts in peptide testing. Purity describes the proportion of the main peptide relative to other detected substances, while potency refers to the biological or functional activity of a defined amount. A highly pure peptide can still have low potency if it is misfolded, aggregated, or chemically modified at a critical residue. Conversely, a less pure preparation may retain high activity if the impurities are inactive. Clear reporting separates these attributes and states the assay used for each.
Peptide purity specifications describe which tests define an acceptable lot and how results are reported. A certificate of analysis commonly lists a reverse-phase HPLC purity value, a mass spectrometry identity result, water content, counterion content, and residual solvent data. The specification may set a minimum area percent, such as 95% or 98%, depending on the intended use and grade. No universal threshold applies to all peptides, because sequence length, hydrophobicity, and manufacturing route influence achievable purity.
Quality control for peptides begins with a documented specification that states the required purity, identity, and appearance. Suppliers often release research-grade material at 95% or greater by HPLC area, but this threshold is not universal. A certificate of analysis typically records the lot number, sequence, test methods, and measured values. The document allows a user to compare batches and to trace deviations. Specifications should match the intended use rather than a generic label.
Storage and handling conditions affect both peptide stability and the accuracy of later purity tests. Lyophilized powders are commonly kept desiccated at -20 °C or below, while reconstituted solutions require a defined buffer, pH, and temperature range. Repeated freeze-thaw cycles can promote aggregation, oxidation, or hydrolysis over time. Each cycle may alter the chromatogram and complicate comparison with earlier results. Stability data, when available, should guide handling intervals and solvent choice.
Independent verification is used when a supplier result needs confirmation or when a material supports regulated work. A second laboratory can repeat reverse-phase HPLC and mass spectrometry on the same sample. Discrepancies may arise from different columns, gradients, detection wavelengths, or sample preparation. Moisture uptake and counterion content can lower net peptide mass without changing area percent. Documentation of methods and raw data helps distinguish analytical variation from a true quality difference.
| Property | Value | Notes |
|---|---|---|
| Typical purity specification | 95% or 98% area by RP-HPLC | Grade and application dependent |
| Common identity test | Electrospray ionization mass spectrometry | Confirms molecular mass |
| Typical water content method | Karl Fischer titration | Reports residual moisture |
| Common counterion test | Ion chromatography | Detects trifluoroacetate or acetate |
| Typical validation elements | Specificity, linearity, precision, accuracy | Follows method-validation guidance |
Quality control includes system suitability, blank injections, and reference standards. System suitability checks column performance and retention time reproducibility, while blank runs detect carryover or mobile-phase contaminants. Reference standards help calibrate retention time and detector response. Without these controls, a purity value is difficult to compare across laboratories or over time. Documentation of instrument settings and integration parameters is also part of quality control, and acceptance criteria should be set before samples are analyzed.
Impurity profiles can include deletion peptides, oxidized forms, truncated sequences, and residual solvents. Some impurities arise during synthesis, cleavage, or purification, while others form during storage. Purity testing often focuses on peptide-related impurities, whereas residual solvents and counterions require separate assays. The significance of a given impurity depends on its amount and properties, which may not be established for a research peptide. Reporting an impurity profile is more informative than reporting a single purity number.
Peptide purity specifications describe the minimum acceptable result from a defined test. A certificate of analysis may list HPLC purity, mass spectrometry identity, appearance, and counterion content. Specifications are method-dependent, so a value obtained with one gradient or wavelength may differ from another. For research use, common thresholds include 95% and 98% by RP-HPLC, but the appropriate limit depends on the application. The specification should always name the analytical method and acceptance criterion.
Orthogonal separation methods address impurities that RP-HPLC may not resolve. Size-exclusion chromatography detects aggregates and higher-order species, while ion-exchange chromatography separates charge variants. Capillary electrophoresis can assess charge-to-mass ratios and, in some formats, size-based impurities. Amino acid analysis and nitrogen determination estimate peptide content rather than chromatographic purity. Because each technique has a different selectivity, a complete purity profile usually combines results from more than one method. The choice of method depends on the impurity classes of concern.
Reversed-phase high-performance liquid chromatography (RP-HPLC) is widely used to estimate peptide purity. Separation depends on interactions between peptide residues and a hydrophobic stationary phase, with gradients of water and organic solvent. Ultraviolet detection near 214 nm responds to the peptide backbone and to many related impurities. The resulting chromatogram is often expressed as area percent, which reports the proportion of peak area assigned to the main component. Different columns, gradients, and wavelengths can produce different purity values for the same material.
Mass spectrometry provides complementary information about molecular identity and certain impurities. Electrospray ionization and matrix-assisted laser desorption/ionization are common ionization techniques for peptides. A measured mass close to the expected value supports correct sequence length and modifications, while extra mass signals can reveal truncations, adducts, or incomplete deprotection. Mass spectrometry alone is not a quantitative purity assay, because ionization efficiency varies between compounds. Coupling liquid chromatography to mass spectrometry links retention time with mass and helps assign peaks that ultraviolet detection records.
Mass spectrometry provides complementary information by measuring molecular mass. Electrospray ionization or matrix-assisted laser desorption/ionization can confirm the expected peptide mass and reveal related impurities with different masses. It does not directly quantify all species because ionization efficiency varies. When coupled to liquid chromatography, LC-MS can assign masses to chromatographic peaks. This helps distinguish target peptide from truncation, oxidation, or deletion products. Mass accuracy and resolution determine how confidently a mass can be matched to a proposed structure.
Other methods address specific purity concerns. Amino acid analysis gives compositional data after hydrolysis, while capillary electrophoresis separates by charge-to-mass ratio. Karl Fischer titration measures residual water, and gas chromatography can detect residual solvents. Nuclear magnetic resonance can identify organic impurities but is less sensitive for trace levels. No single test covers all possible impurities, so purity testing usually combines orthogonal methods and reports the conditions used. The choice of methods is guided by the impurity classes of interest.
The most common peptide aptamer selection system is the yeast two-hybrid system. Peptide aptamers can also be selected from combinatorial peptide libraries constructed by phage display and other surface display technologies such as mRNA display, ribosome display, bacterial display and yeast display. These experimental procedures are also known as biopanning. All the peptides panned from combinatorial peptide libraries have been stored in the MimoDB database.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
The effects are varied depending on the particular drug given. When anesthetists administer standard doses of these anesthetic drugs to a person with butyrylcholinesterase deficiency, the patient experiences prolonged paralysis of the respiratory muscles, requiring an extended period of time during which the patient must be mechanically ventilated. Eventually the muscle-paralyzing effects of these drugs will wear off despite the deficiency of the pseudocholinesterase enzyme. If the patient is maintained on a mechanical respirator until normal breathing function returns, there is little risk of harm to the patient. Because it is rare in the general population the deficiency is sometimes overlooked when a patient does not wake up after surgery. If this happens, there are two major complications that can arise. First, the patient may lie awake and paralyzed while medical providers try to determine the cause of the patient's unresponsiveness. Second, the breathing tube may be removed before the patient is strong enough to breathe properly, potentially causing respiratory arrest. This enzyme abnormality is a benign condition unless a person with burtyrylcholinesterase deficiency is exposed to the offending pharmacological agents.
Sources: en.wikipedia.org
Color markers are sometimes added to loading dyes for gel electrophoresis in the separation of DNA fragments. Loading dyes keep DNA samples below the surface of the agarose gel, and the color markers within help keep track of the migration front of the DNA as it moves along the gel. For PAGE, some commercially available molecular weight markers (also called "ladders" because they look like the rungs of a ladder after separation) contain pre-stained proteins of different colours, so it is possible to determine more accurately where the proteins of interest in the samples might be.
This detection method uses mammalian antibodies to bind to microbial toxins which can then be processed in a variety of different ways. Of the commercial ways of using immunochemical detection would be enzyme-linked immunosorbent assays (ELISA). This assay has the advantage of being able to screen for a broad range of toxins but could have issues with specificity depending on the antibody used. A more exotic setup involves the use of CdS quantum dots which are used in an electro-chemiluminescent immunosensor. A major aspect of immunochemical methods being tested in laboratories are uses of nanowires and other nanomaterials to detect microbial toxins.
An alcohol burner or spirit lamp is a piece of laboratory equipment used to produce an open flame. It can be made from brass, glass, stainless steel or aluminium. Alcohol burners are preferred for some uses over Bunsen burners for safety purposes, and in laboratories where natural gas is not available. Their flame is limited to approximately 5 centimeters (two inches) in height, with a comparatively lower temperature than the gas flame of the Bunsen burner. While they do not produce flames as hot as other types of burners, they are sufficiently hot for performing some chemistries, standard microbiology laboratory procedures, and can be used for flame sterilization of other laboratory equipment. A small alcohol burner is also preferred for camping when the need for fire is modest. It burns the alcohol vapor that rises due to the heat from the flame through the holes on the top perimeter of the container. Typical fuel is denatured alcohol, methanol, or isopropanol. A cap is used as a snuffer for extinguishing the flame.
There are over 100 reported pathogenic, or disease-causing, variants in the ASH1L gene. About half of the variants arise de novo, and half are inherited. Of the inherited variants, about half are maternally inherited and half are paternally inherited. Disease-causing variants may be missense, nonsense, or frameshift mutations. The missense mutations are distributed throughout the gene body without localizing to a known functional domain of ASH1L. All affected humans are heterozygous for ASH1L mutations. A single pathogenic copy of ASH1L causes disease, which may be the result of two different genetic mechanisms: haploinsufficiency or dominant negative function. The ClinGen clinical genomics resource states that there is "Sufficient Evidence for Haploinsufficiency" in ASH1L. The most common phenotypes, or symptoms, related to ASH1L mutations are autism spectrum disorder (ASD), epilepsy, intellectual disability, and attention deficit hyperactivity disorder (ADHD). The Simons Foundation Autism Research Initiative (SFARI) gives ASH1L a score of 1.1, indicating that ASH1L is a high confidence autism gene with the best level of evidence linking it to autism.
Sources: en.wikipedia.org
Aaron R. Wheeler is a Canadian chemist who is a professor of chemistry and biomedical engineering at the University of Toronto since 2005 with cross-appointment at Institute of Biomedical Engineering and Terrence Donnelly Centre for Cellular and Biomolecular Research. His academic laboratory is located at Lash Miller Chemical Laboratories and Terrence Donnelly Centre for Cellular and Biomolecular Research at the University of Toronto. In 2005, Wheeler was appointed as assistant professor and Tier II Canada Research Chair then promoted to associate professor in 2010, full professor in 2013, and in 2018 he became the Tier I Canada Research Chair in Microfluidic Bioanalysis. Wheeler did his undergraduate studies at Furman University in Greenville, SC then he joined Stanford University from 1997 to 2003 to obtain his Ph.D. in chemistry under supervision of Richard Zare . Following graduation, he took a two-year NIH postdoctoral fellowship at UCLA till 2005.
Mutations in the untranslated region (UTR) affect many post-transcriptional regulation. Distinctive structural features are required for many RNA molecules and cis-acting regulatory elements to execute effective functions during gene regulation. SNVs can alter the secondary structure of RNA molecules and then disrupt the proper folding of RNAs, such as tRNA/mRNA/lncRNA folding and miRNA binding recognition regions. Single nucleotide variant can also affect the cis-acting regulatory elements in mRNA's to inhibit/promote the translation initiation. Change in the synonymous codons region due to mutation may affect the translation efficiency because of codon usage biases. The translation elongation can also be retarded by mutations along the ramp of ribosomal movement. In the post-translational level, genetic variants can contribute to proteostasis and amino acid modifications. However, mechanisms of variant effect in this field are complicated and there are only a few tools available to predict variant's effect on translation related modifications.
A neurotransmitter prodrug, or neurotransmitter precursor, is a drug that acts as a prodrug of a neurotransmitter. A variety of neurotransmitter prodrugs have been developed and used in medicine. They can be useful when the neurotransmitter itself is not suitable for use as a pharmaceutical drug owing to unfavorable pharmacokinetic or physicochemical properties, for instance high susceptibility to metabolism, short elimination half-life, or lack of blood–brain barrier permeability. Besides their use in medicine, neurotransmitter prodrugs have also been used as recreational drugs in some cases.
From 2011, new cars should have brake assist system in the EU, according to The Pedestrian Protection Regulation (EC) 78/2009. Starting in 2012, all cars under 10,000 lbs. sold in the US are required to have Electronic Stability Control. In 2014, ESP (Electronic Stability Program) and TPMS became mandatory in the European Union, with also the driver seat belt reminder and the ISOFIX system, under General Safety Regulation (EC) No 661/2009. In 2015, recognizing that safer roads are a shared responsibility, Together for Safer Roads (TSR) was formally launched to align the private sector's road safety efforts with the United Nations Decade of Action for Road Safety. In 2016 and 2017, ABS became mandatory on motorcycles in the EU. In 2018, eCall became mandatory in the EU, and reverse camera in the US. In 2019, the EU legislated to revise the General Safety Regulation (GSR), the revision includes the following automotive safety features:
Chromatin remodelers in the INO80 subfamily are made of multiple subunit complexes with split ATPase domains. The INO80 subfamily's protein domains are an N-terminus, two RuvB-like proteins (Rvb1 and Rvb2), and a C-terminus. The ATPase domain of the N-terminus functions in the identification of DNA damage and aids in the stability of telomeres. A long insertion in the ATPase domain is what recruits the Rvb1 and Rvb2 helicases. These helicases contribute to genome maintenance and are unique to the INO80 subfamily of chromatin remodeling complexes. This subfamily also contains an Arp4-actin complex that aids in stability of genes. The Arp5 subunit is required for ATPase function, binding to the DNA, and relocation of nucleosomes.
Sources: en.wikipedia.org
Purity percentages vary because each laboratory uses its own column, mobile phase, gradient, detection wavelength, and integration settings. A 95% value from one method may not equal 95% from another method. Comparative assessment requires the same validated procedure or an orthogonal cross-check.
A useful certificate of analysis states the peptide sequence, lot number, test methods, acceptance criteria, and measured results. It typically reports HPLC purity, mass spectrometry identity, water content, counterion content, and residual solvents when relevant. The document should also include a chromatogram and the date of testing.
Higher HPLC purity reduces the relative amount of ultraviolet-detectable impurities, but it does not guarantee correct sequence, stereochemistry, or biological activity. Some impurities may be invisible to the chosen method, and aggregates or counterions may still be present. Fitness for purpose depends on the intended application and the full set of tests.
Lyophilized powders are typically kept desiccated at -20 °C or below. Reconstituted solutions require a defined buffer, pH, and storage condition based on available stability data.